PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_124887g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 209aa    MW: 23609.7 Da    PI: 8.1659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_124887g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ ++ +G g+W+t ++  g+ R++k+c++rw +yl
   MA_124887g0010 14 KGAWTKEEDARLVQHIQAHGEGCWRTLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.13.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++Ed+l+++++++lG++ W++Ia +++ gRt+ ++k++w+++l
   MA_124887g0010  67 RGYFSEDEDDLILKLHALLGNK-WSLIAGRLP-GRTDDEIKNYWNSHL 112
                      799*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.185961IPR017930Myb domain
SMARTSM007177.4E-131363IPR001005SANT/Myb domain
SuperFamilySSF466894.31E-2813108IPR009057Homeodomain-like
PfamPF002491.4E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-211568IPR009057Homeodomain-like
CDDcd001674.13E-101661No hitNo description
PROSITE profilePS5129425.63562116IPR017930Myb domain
SMARTSM007177.8E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2669116IPR009057Homeodomain-like
CDDcd001673.69E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRAPCCPSG DGNKGAWTKE EDARLVQHIQ AHGEGCWRTL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGYF SEDEDDLILK LHALLGNKWS LIAGRLPGRT DDEIKNYWNS HLKRNMIMGL  120
DPLAHRPFQK NSRHHRSAPG NVKEPETVRS HEIVQDLFHC TSELSVKSEQ VSDAASELAR  180
DEHPHLNLNL ELSITRPSIQ AAGKEDVVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1135040.0BT113504.1 Picea glauca clone GQ03411_H16 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195574.16e-80transcription repressor MYB4
SwissprotQ9SZP17e-82MYB4_ARATH; Transcription repressor MYB4
TrEMBLA9NTK01e-119A9NTK0_PICSI; Putative uncharacterized protein
STRINGAT4G38620.12e-79(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-83myb domain protein 4